SMCR7L Antibody
| Name | SMCR7L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79453 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the C terminal of human HSU79252. Peptide sequence HLVVFKFLVPEAKSTTCLLVTCLPAVVVDVLAGRFGISHQSFCTVLVSSI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MIEF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SMCR7L Antibody [NBP1-79453] - Human Heart lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16527_SMCR7L-Antibody-Western-Blot-NBP1-79453-img0003.jpg)
Western Blot: SMCR7L Antibody [NBP1-79453] - Human Heart lysate, concentration 0.2-1 ug/ml.