ARID5A Antibody

Name ARID5A Antibody
Supplier Novus Biologicals
Catalog NBP1-79452
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human ARID5AThe immunogen for this antibody is ARID5A (NP_997646). Peptide sequence MAAPVKGNRKQSTEGDALDPPASPKPAGKQNGIQNPISLEDSPEAGGERE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARID5A
Conjugate Unconjugated
Supplier Page Shop

Product images