JHDM1D Antibody
| Name | JHDM1D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79714 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen this antibody was a synthetic peptide directed towards the C terminal region of human JHDM1D. Sequence: CGYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRV |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | KDM7A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: JHDM1D Antibody [NBP1-79714] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7060_JHDM1D%2520Antibody-Western%2520Blot-NBP1-79714-img0002.jpg)
Western Blot: JHDM1D Antibody [NBP1-79714] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.