KCTD11 Antibody

Name KCTD11 Antibody
Supplier Novus Biologicals
Catalog NBP1-80211
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human KCTD11. Peptide sequence ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene KCTD11
Supplier Page Shop

Product images