| Name | SRp55 Antibody (5G6) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00006431-M02 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone | 5G6 |
| Applications | WB ELISA ICC/IF |
| Species Reactivities | Human |
| Antigen | SFRS6 (NP_006266, 1 a.a. - 75 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | SRSF6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |