ZIC3 Antibody (4G6)

Name ZIC3 Antibody (4G6)
Supplier Novus Biologicals
Catalog H00007547-M04
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2b Kappa
Clone 4G6
Applications WB ELISA
Species Reactivities Human
Antigen ZIC3 (NP_003404.1, 182 a.a. - 274 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST
Purity/Format IgG purified
Description Mouse Monoclonal
Gene ZIC3
Conjugate Unconjugated
Supplier Page Shop

Product images