SPOP Antibody (3E2.)

• Supplier: Novus Biologicals
• Catalog: H00008405-M04
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 3E2.
• Applications: WB ELISA
• Species Reactivities: Human
• Antigen: SPOP (NP_001007227.1 301 a.a. - 374 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: SPOP
• Conjugate: Unconjugated