TFCP2 Antibody (3H6)
| Name | TFCP2 Antibody (3H6) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00007024-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Lambda |
| Clone | 3H6 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | TFCP2 (AAH03634 414 a.a. - 502 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KHEDGDSNGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQEEACFILDTMKAETNDSYHIILK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | TFCP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TFCP2 Antibody (3H6) [H00007024-M01] - Analysis of TFCP2 expression in transfected 293T cell line by TFCP2 monoclonal antibody (M01), clone 3H6.Lane 1: TFCP2 transfected lysate(57.3 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10732_TFCP2%2520Antibody%2520(3H6)-Western%2520Blot-H00007024-M01-img0003.jpg)
Western Blot: TFCP2 Antibody (3H6) [H00007024-M01] - Analysis of TFCP2 expression in transfected 293T cell line by TFCP2 monoclonal antibody (M01), clone 3H6.Lane 1: TFCP2 transfected lysate(57.3 KDa).Lane 2: Non-transfected lysate.
![Sandwich ELISA: TFCP2 Antibody (3H6) [H00007024-M01] - Detection limit for recombinant GST tagged TFCP2 is approximately 0.3ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10733_TFCP2-Antibody-(3H6)-Sandwich-ELISA-H00007024-M01-img0002.jpg)
Sandwich ELISA: TFCP2 Antibody (3H6) [H00007024-M01] - Detection limit for recombinant GST tagged TFCP2 is approximately 0.3ng/ml as a capture antibody.