SLC22A12 Antibody

Name SLC22A12 Antibody
Supplier Novus Biologicals
Catalog NBP1-69538
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC22A12(solute carrier family 22 (organic anion/urate transporter), member 12) The peptide sequence was selected from the N terminal of SLC22A12. Peptide sequence SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALL
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC22A12
Conjugate Unconjugated
Supplier Page Shop

Product images