Ephrin-A5 Antibody (1A2)

• Supplier: Novus Biologicals
• Catalog: H00001946-M02
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 1A2
• Applications: WB ELISA
• Species Reactivities: Human
• Antigen: EFNA5 (NP_001953 114 a.a. - 203 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: EFNA5
• Conjugate: Unconjugated