Name | GCHFR Antibody (4G6) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00002644-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2b Kappa |
Clone | 4G6 |
Applications | ELISA ICC/IF |
Species Reactivities | Human |
Antigen | GCHFR (NP_005249.1, 1 a.a. - 84 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | GCHFR |
Conjugate | Unconjugated |
Supplier Page | Shop |