| Name | FKBP12.6 Antibody (4H5-1B6) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00002281-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 4H5-1B6 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | FKBP1B (AAH02614, 1 a.a. - 80 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | FKBP1B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |