5-HT1E Antibody (2E9.)
| Name | 5-HT1E Antibody (2E9.) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00003354-M03 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 2E9. |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | HTR1E (NP_000856.1 206 a.a. - 276 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPG |
| Purity/Format | Protein A purified |
| Description | Mouse Monoclonal |
| Gene | HTR1E |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: 5-HT1E Antibody (2E9) [H00003354-M03] - Detection limit for recombinant GST tagged HTR1E is 0.3 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10135_5-HT1E-Antibody-(2E9)-Sandwich-ELISA-H00003354-M03-img0001.jpg)
Sandwich ELISA: 5-HT1E Antibody (2E9) [H00003354-M03] - Detection limit for recombinant GST tagged HTR1E is 0.3 ng/ml as a capture antibody.