Zic2 Antibody (3C12)

• Supplier: Novus Biologicals
• Catalog: H00007546-M01
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 3C12
• Applications: WB ELISA
• Species Reactivities: Human
• Antigen: ZIC2 (NP_009060, 151 a.a. - 216 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDAQGHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPY
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: ZIC2
• Conjugate: Unconjugated