Zic2 Antibody (3H7)

• Supplier: Novus Biologicals
• Catalog: H00007546-M08
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 3H7
• Applications: WB ELISA
• Species Reactivities: Human
• Antigen: ZIC2 (NP_009060, 130 a.a. - 220 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APGGGQHGLFGPGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMRLGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNMN
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: ZIC2
• Conjugate: Unconjugated