Protocadherin-8 Antibody (1C5)
| Name | Protocadherin-8 Antibody (1C5) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00005100-M02 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 1C5 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | PCDH8 (NP_002581, 32 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRYSTFEEDAPGTVIGTLAEDLHMKVSGDTSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | PCDH8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: Protocadherin-8 Antibody (1C5) [H00005100-M02] - Detection limit for recombinant GST tagged PCDH8 is 0.1 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/18174_Protocadherin-8%2520Antibody%2520(1C5)-Sandwich%2520ELISA-H00005100-M02-img0001.jpg)
Sandwich ELISA: Protocadherin-8 Antibody (1C5) [H00005100-M02] - Detection limit for recombinant GST tagged PCDH8 is 0.1 ng/ml as a capture antibody.