SLC7A7 Antibody (3B10)
| Name | SLC7A7 Antibody (3B10) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00009056-M04 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone | 3B10 |
| Applications | ELISA |
| Species Reactivities | Human |
| Antigen | SLC7A7 (NP_003973.2 462 a.a. - 511 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | SLC7A7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: SLC7A7 Antibody (3B10) [H00009056-M04] - Detection limit for recombinant GST tagged SLC7A7 is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/21702_SLC7A7%2520Antibody%2520(3B10)-Sandwich%2520ELISA-H00009056-M04-img0002.jpg)
Sandwich ELISA: SLC7A7 Antibody (3B10) [H00009056-M04] - Detection limit for recombinant GST tagged SLC7A7 is approximately 0.1ng/ml as a capture antibody.