| Name | FOXA3 Antibody (1C6) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00003171-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 1C6 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | FOXA3 (NP_004488.2, 266 a.a. - 350 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS |
| Purity/Format | Protein A purified |
| Description | Mouse Monoclonal |
| Gene | FOXA3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |