ELK4 Antibody (3D1)
| Name | ELK4 Antibody (3D1) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00002005-M02 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 3D1 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | ELK4 (NP_001964.2 118 a.a. - 206 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAA |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | ELK4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: ELK4 Antibody (3D1) [H00002005-M02] - Detection limit for recombinant GST tagged ELK4 is 3 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/18378_ELK4%2520Antibody%2520(3D1)-Sandwich%2520ELISA-H00002005-M02-img0001.jpg)
Sandwich ELISA: ELK4 Antibody (3D1) [H00002005-M02] - Detection limit for recombinant GST tagged ELK4 is 3 ng/ml as a capture antibody.