Asporin Antibody

Name Asporin Antibody
Supplier Novus Biologicals
Catalog NBP1-58061
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to ASPN(asporin) The peptide sequence was selected from the middle region of ASPN. Peptide sequence NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ASPN
Conjugate Unconjugated
Supplier Page Shop

Product images