GLS2 Antibody
| Name | GLS2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81856 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDHDSSESGMLSRLGDLLFY |
| Description | Rabbit Polyclonal |
| Gene | GLS2 |
| Supplier Page | Shop |
Product images
![Western Blot: GLS2 Antibody [NBP1-81856] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/12898_GLS2-Antibody-Western-Blot-NBP1-81856-img0006.jpg)
Western Blot: GLS2 Antibody [NBP1-81856] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).
![Immunohistochemistry-Paraffin: GLS2 Antibody [NBP1-81856] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/12899_GLS2-Antibody-Immunohistochemistry-Paraffin-NBP1-81856-img0002.jpg)
Immunohistochemistry-Paraffin: GLS2 Antibody [NBP1-81856] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
![Western Blot: GLS2 Antibody [NBP1-81856] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/12900_GLS2-Antibody-Western-Blot-NBP1-81856-img0005.jpg)
Western Blot: GLS2 Antibody [NBP1-81856] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp