HM74A/PUMA-G/GPR109A/NIACR1 Antibody
| Name | HM74A/PUMA-G/GPR109A/NIACR1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92180 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HM74A/PUMA-G/GPR109A/NIACR1 Protein |
| Description | Rabbit Polyclonal |
| Gene | HCAR2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180] - Immunofluorescent staining of human cell line RT4 shows localization to cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/15264_HM74A-PUMA-G-GPR109A-NIACR1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92180-img0005.jpg)
Immunocytochemistry/Immunofluorescence: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180] - Immunofluorescent staining of human cell line RT4 shows localization to cell junctions.
![Immunohistochemistry-Paraffin: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/15265_HM74A-PUMA-G-GPR109A-NIACR1-Antibody-Immunohistochemistry-Paraffin-NBP1-92180-img0004.jpg)
Immunohistochemistry-Paraffin: HM74A/PUMA-G/GPR109A/NIACR1 Antibody [NBP1-92180] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.