Name | DIO1 Antibody (1E4.) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00001733-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 1E4. |
Applications | ELISA |
Species Reactivities | Human |
Antigen | DIO1 (NP_000783.2, 35 a.a. - 125 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | DIO1 |
Conjugate | Unconjugated |
Supplier Page | Shop |