CXCL6/GCP-2 Antibody (2G3)

• Supplier: Novus Biologicals
• Catalog: H00006372-M07
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b Kappa
• Clone: 2G3
• Applications: ELISA
• Species Reactivities: Human
• Antigen: CXCL6 (AAH13744, 38 a.a. - 114 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: CXCL6
• Conjugate: Unconjugated