SNRPB Antibody (1B4)

Name SNRPB Antibody (1B4)
Supplier Novus Biologicals
Catalog H00006628-M01
Prices $349.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG1 Kappa
Clone 1B4
Applications ELISA
Species Reactivities Human
Antigen SNRPB (NP_003082, 1 a.a. - 80 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
Purity/Format IgG purified
Description Mouse Monoclonal
Gene SNRPB
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.