Anti-ANKLE2 antibody
| Name | Anti-ANKLE2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83830 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ELISA WB |
| Species Reactivities | Human, Cat |
| Antigen | Synthetic peptide corresponding to a region within the middle amino acids 864-913 ( CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG ) of Human ANKLE2 (NP_055929) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ANKLE2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ANKLE2 antibody (ab83830) at 1 µg/ml (in 5% skim milk / PBS buffer) + 10ug 293T cell lysateSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution