Anti-APOBEC3B antibody
| Name | Anti-APOBEC3B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab104759 |
| Prices | $376.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Horse, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 78-127 ( NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW ) of human APOBEC3B (NP_004891) |
| Description | Rabbit Polyclonal |
| Gene | APOBEC3B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-APOBEC3B antibody (ab104759) at 0.25 µg/ml + HepG2 cell lysate at 10 µg