Anti-APXL antibody
| Name | Anti-APXL antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86265 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 1296-1345 of Human APXL ( TSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTMD ); NP_001640 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | SHROOM2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-APXL antibody (ab86265) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal lung lysate (Human) at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution