Anti-ATX2 antibody
| Name | Anti-ATX2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94652 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 1264-1313 ( APMMLMTTQPPGGPQAALAQSALQPIPVSTTAHFPYMTHPSVQAHHQQQL ) of Human ATX2 (NP_002964) |
| Description | Rabbit Polyclonal |
| Gene | ATXN2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ATX2 antibody (ab94652) at 1 µg/ml ( in 5% skim milk / PBS buffer) + PANC1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution