Anti-BTBD10 antibody
| Name | Anti-BTBD10 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83085 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Rabbit, Horse, Chicken, Guinea Pig, Dog, Zebra finch |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMS L) of Human BTBD10 (NP_115696) |
| Description | Rabbit Polyclonal |
| Gene | BTBD10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-BTBD10 antibody (ab83085) at 1 µg/ml + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilutionObserved band size : 54 kDa (why is the actual band size different from the predicted?)