Name | Anti-C9ORF46 antibody |
---|---|
Supplier | Abcam |
Catalog | ab82868 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB ELISA |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Cat, Dog, Pig |
Antigen | Synthetic peptide corresponding to a region within amino acids 72-121 ( AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL ) of human C9orf46 (NP_060935) |
Description | Rabbit Polyclonal |
Gene | PLGRKT |
Conjugate | Unconjugated |
Supplier Page | Shop |