Anti-C9ORF46 antibody
| Name | Anti-C9ORF46 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab82868 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within amino acids 72-121 ( AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL ) of human C9orf46 (NP_060935) |
| Description | Rabbit Polyclonal |
| Gene | PLGRKT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C9ORF46 antibody (ab82868) at 1 µg/ml (in 5% skim milk / PBS buffer) + human fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG diluted at 1/50000 dilution