Anti-CACNA1G + CACNA1H antibody
| Name | Anti-CACNA1G + CACNA1H antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab95092 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 1908-1957 ( SRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTSY ) of Human CACNA1G (NP_938202) |
| Description | Rabbit Polyclonal |
| Gene | CACNA1H |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CACNA1G + CACNA1H antibody (ab95092) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal spleen lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human brain, cortex tissue labelling CACNA1G + CACNA1H with ab95092 at 2.5µg/ml.