Anti-CD130 (gp130) antibody
| Name | Anti-CD130 (gp130) antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab128618 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 158-207 ( FTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKV ) of Human CD130(gp130) isoform 2 (NP_786943) |
| Description | Rabbit Polyclonal |
| Gene | IL6ST |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CD130 (gp130) antibody (ab128618) at 1 µg/ml + MDA-MB-435S cell lysate