Anti-CD299 antibody
| Name | Anti-CD299 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102060 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 323-372 ( NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS ) of Human CD299 (NP_055072) |
| Description | Rabbit Polyclonal |
| Gene | CLEC4M |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CD299 antibody (ab102060) at 1 µg/ml + Human fetal kidney lysate at 10 µg