MSH2 antibody

Name MSH2 antibody
Supplier Fitzgerald
Catalog 70R-1634
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Dog, Zebrafish
Antigen MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV
Purity/Format Total IgG Protein A purified
Blocking Peptide MSH2 Blocking Peptide
Description Rabbit polyclonal MSH2 antibody
Gene MSH2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.