| Name | Peptidase D antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4294 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Peptidase D antibody was raised using the middle region of PEPD corresponding to a region with amino acids LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV |
| Purity/Format | Affinity purified |
| Blocking Peptide | Peptidase D Blocking Peptide |
| Description | Rabbit polyclonal Peptidase D antibody raised against the middle region of PEPD |
| Gene | PEPD |
| Supplier Page | Shop |