| Name | OSBPL1A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4070 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | OSBPL1A antibody was raised using the middle region of OSBPL1A corresponding to a region with amino acids EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI |
| Purity/Format | Affinity purified |
| Blocking Peptide | OSBPL1A Blocking Peptide |
| Description | Rabbit polyclonal OSBPL1A antibody raised against the middle region of OSBPL1A |
| Gene | OSBPL1A |
| Supplier Page | Shop |