Name | OSBPL1A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4070 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | OSBPL1A antibody was raised using the middle region of OSBPL1A corresponding to a region with amino acids EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSI |
Purity/Format | Affinity purified |
Blocking Peptide | OSBPL1A Blocking Peptide |
Description | Rabbit polyclonal OSBPL1A antibody raised against the middle region of OSBPL1A |
Gene | OSBPL1A |
Supplier Page | Shop |