NDFIP2 antibody

Name NDFIP2 antibody
Supplier Fitzgerald
Catalog 70R-4486
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NDFIP2 antibody was raised using the middle region of NDFIP2 corresponding to a region with amino acids SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL
Purity/Format Affinity purified
Blocking Peptide NDFIP2 Blocking Peptide
Description Rabbit polyclonal NDFIP2 antibody raised against the middle region of NDFIP2
Gene NDFIP2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.