Name | FBXO31 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2500 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | FBXO31 antibody was raised using the middle region of FBXO31 corresponding to a region with amino acids VAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTS |
Purity/Format | Affinity purified |
Blocking Peptide | FBXO31 Blocking Peptide |
Description | Rabbit polyclonal FBXO31 antibody raised against the middle region of FBXO31 |
Gene | FBXO31 |
Supplier Page | Shop |