Name | TMEM16C antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6548 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | TMEM16C antibody was raised using the middle region of TMEM16C corresponding to a region with amino acids WWSRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIF |
Purity/Format | Affinity purified |
Blocking Peptide | TMEM16C Blocking Peptide |
Description | Rabbit polyclonal TMEM16C antibody raised against the middle region of TMEM16C |
Gene | ANO3 |
Supplier Page | Shop |