Rhotekin antibody

Name Rhotekin antibody
Supplier Fitzgerald
Catalog 70R-3077
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen Rhotekin antibody was raised using the middle region of RTKN corresponding to a region with amino acids IETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPP
Purity/Format Affinity purified
Blocking Peptide Rhotekin Blocking Peptide
Description Rabbit polyclonal Rhotekin antibody raised against the middle region of RTKN
Gene RTKN
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.