| Name | FDXR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2532 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FDXR antibody was raised using the middle region of FDXR corresponding to a region with amino acids LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW |
| Purity/Format | Affinity purified |
| Blocking Peptide | FDXR Blocking Peptide |
| Description | Rabbit polyclonal FDXR antibody raised against the middle region of FDXR |
| Gene | FDXR |
| Supplier Page | Shop |