Name | FDXR antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2532 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FDXR antibody was raised using the middle region of FDXR corresponding to a region with amino acids LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAW |
Purity/Format | Affinity purified |
Blocking Peptide | FDXR Blocking Peptide |
Description | Rabbit polyclonal FDXR antibody raised against the middle region of FDXR |
Gene | FDXR |
Supplier Page | Shop |