| Name | MKNK2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5832 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MKNK2 antibody was raised using the N terminal of MKNK2 corresponding to a region with amino acids SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL |
| Purity/Format | Affinity purified |
| Blocking Peptide | MKNK2 Blocking Peptide |
| Description | Rabbit polyclonal MKNK2 antibody raised against the N terminal of MKNK2 |
| Gene | MKNK2 |
| Supplier Page | Shop |