| Name | GLRX3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4390 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR |
| Purity/Format | Affinity purified |
| Blocking Peptide | GLRX3 Blocking Peptide |
| Description | Rabbit polyclonal GLRX3 antibody raised against the N terminal of GLRX3 |
| Gene | GLRX3 |
| Supplier Page | Shop |