| Name | AADAT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1120 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | AADAT antibody was raised using the N terminal of AADAT corresponding to a region with amino acids AVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTI |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | AADAT Blocking Peptide |
| Description | Rabbit polyclonal AADAT antibody raised against the N terminal of AADAT |
| Gene | AADAT |
| Supplier Page | Shop |