POMT2 antibody

• Supplier: Fitzgerald
• Catalog: 70R-6997
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human, Mouse, Rat
• Antigen: POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPS
• Purity/Format: Affinity purified
• Blocking Peptide: POMT2 Blocking Peptide
• Description: Rabbit polyclonal POMT2 antibody raised against the middle region of POMT2
• Gene: POMT2