| Name | ST3GAL1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7382 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | ST3GAL1 antibody was raised using the C terminal of ST3GAL1 corresponding to a region with amino acids YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN |
| Purity/Format | Affinity purified |
| Blocking Peptide | ST3GAL1 Blocking Peptide |
| Description | Rabbit polyclonal ST3GAL1 antibody raised against the C terminal of ST3GAL1 |
| Gene | ST3GAL1 |
| Supplier Page | Shop |