| Name | PRKRA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5897 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PRKRA antibody was raised using the N terminal of PRKRA corresponding to a region with amino acids MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP |
| Purity/Format | Affinity purified |
| Blocking Peptide | PRKRA Blocking Peptide |
| Description | Rabbit polyclonal PRKRA antibody raised against the N terminal of PRKRA |
| Gene | PRKRA |
| Supplier Page | Shop |