PCSK5 antibody

Name PCSK5 antibody
Supplier Fitzgerald
Catalog 70R-5352
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PCSK5 antibody was raised using the middle region of PCSK5 corresponding to a region with amino acids CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS
Purity/Format Affinity purified
Blocking Peptide PCSK5 Blocking Peptide
Description Rabbit polyclonal PCSK5 antibody raised against the middle region of PCSK5
Gene PCSK5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.