| Name | BECN1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5935 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | BECN1 antibody was raised using the N terminal of BECN1 corresponding to a region with amino acids MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL |
| Purity/Format | Affinity purified |
| Blocking Peptide | BECN1 Blocking Peptide |
| Description | Rabbit polyclonal BECN1 antibody raised against the N terminal of BECN1 |
| Gene | BECN1 |
| Supplier Page | Shop |